Listening on http://127.0.0.1:36129 Warning in dir.create(rawfileReaderDLLsPath, recursive = TRUE) : cannot create dir '/var/www/.cache', reason 'Permission denied' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.Data.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.Data.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.MassPrecisionEstimator.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.MassPrecisionEstimator.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.RawFileReader.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.RawFileReader.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in dir.create(rawrrAssemblyPath(), recursive = TRUE) : cannot create dir '/var/www/.cache', reason 'Permission denied' Warning in download.file(sourceUrl, destfile = rawrrAssembly, mode = "wb", : URL https://github.com/fgcz/rawrr/releases/download/1.7.10/rawrr.1.7.10.exe: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/rawrr.exe', reason 'No such file or directory' Warning in download.file(sourceUrl, destfile = rawrrAssembly, mode = "wb", : download had nonzero exit status MD5 NA /var/www/.cache/R/rawrr/rawrrassembly/rawrr.exe Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#81] 96: func 83: renderFunc 82: output$peptides 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#90] 96: func 83: renderFunc 82: output$fragments 1: runApp 1 NA NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 1 20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 1 20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw NAHSATTWSGQYVGGAEAR 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#81] 96: func 83: renderFunc 82: output$peptides 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#90] 96: func 83: renderFunc 82: output$fragments 1: runApp 2 NA NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 NA YDSAPATDGSGTALGWTVAWKNAHSATTWSGQYVGGAEAR 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 20210608_005_S300851_DynabeadsMyOneStreptavidinT1.raw YDSAPATDGSGTALGWTVAWKNAHSATTWSGQYVGGAEAR 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning in dir.create(rawfileReaderDLLsPath, recursive = TRUE) : cannot create dir '/var/www/.cache', reason 'Permission denied' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.Data.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.Data.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.MassPrecisionEstimator.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.MassPrecisionEstimator.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : URL https://github.com/thermofisherlsms/ThermoRawFileParser/raw/master/packages/ThermoFisher.CommonCore.RawFileReader.4.0.26/lib//ThermoFisher.CommonCore.RawFileReader.dll: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/ThermoFisher.CommonCore.RawFileReader.dll', reason 'No such file or directory' Warning in download.file(file.path(sourceUrl, dll), destfile = destfile, : download had nonzero exit status Warning in dir.create(rawrrAssemblyPath(), recursive = TRUE) : cannot create dir '/var/www/.cache', reason 'Permission denied' Warning in download.file(sourceUrl, destfile = rawrrAssembly, mode = "wb", : URL https://github.com/fgcz/rawrr/releases/download/1.7.10/rawrr.1.7.10.exe: cannot open destfile '/var/www/.cache/R/rawrr/rawrrassembly/rawrr.exe', reason 'No such file or directory' Warning in download.file(sourceUrl, destfile = rawrrAssembly, mode = "wb", : download had nonzero exit status MD5 NA /var/www/.cache/R/rawrr/rawrrassembly/rawrr.exe Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#81] 96: func 83: renderFunc 82: output$peptides 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#90] 96: func 83: renderFunc 82: output$fragments 1: runApp 1 NA NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 1 20210608_003_S300849_DynabeadsM-270Streptavidin.raw NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 1 20210608_003_S300849_DynabeadsM-270Streptavidin.raw NAHSATTWSGQYVGGAEAR 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning: Error in .checkRawFileReaderDLLs: 'ThermoFisher.CommonCore.*.dll' files are not available on the system. Run 'rawrr::installRawFileReaderDLLs()' or setenv MONO_PATH to the location where the assemblies are located. For more information, type '?ThermoFisher'. 219: FUN 218: .checkRawFileReaderDLLs 217: .isAssemblyWorking 216: FUN 215: lapply 214: parallel::mclapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#160] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#206] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#78] 96: func 83: renderFunc 82: output$peptides 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#87] 96: func 83: renderFunc 82: output$fragments 1: runApp 1 NA NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 20210608_003_S300849_DynabeadsM-270Streptavidin.raw20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 20210608_003_S300849_DynabeadsM-270Streptavidin.raw20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw INTQWLLTSGTTEANAWKSTLVGHDTFTK 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#78] 96: func 83: renderFunc 82: output$peptides 1: runApp Warning: Error in if: argument is of length zero 97: renderUI [/export/data01/shiny/rawrr/server.R#87] 96: func 83: renderFunc 82: output$fragments 1: runApp 1 NA NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw20210608_005_S300851_DynabeadsMyOneStreptavidinT1.raw NA 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp 2 20210608_004_S300850_DynabeadsMyOneStreptavidinC1.raw20210608_005_S300851_DynabeadsMyOneStreptavidinT1.raw NAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWK 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. 'ThermoFisher.CommonCore.Data.dll' is missing. 'ThermoFisher.CommonCore.MassPrecisionEstimator.dll' is missing. 'ThermoFisher.CommonCore.RawFileReader.dll' is missing. Warning in parallel::mclapply(rf, FUN = rawrr::readChromatogram, mass = ion, : all scheduled cores encountered errors in user code Warning in y[[i]]$peptide <- ion.peptide[i] : Coercing LHS to a list Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp Warning: Error in <-: more elements supplied than there are to replace 218: FUN [/export/data01/shiny/rawrr/server.R#170] 217: lapply 213: eventReactiveValueFunc [/export/data01/shiny/rawrr/server.R#166] 211: valueFunc 198: func 196: f 195: Reduce 186: do 185: hybrid_chain 184: 183: .func 180: contextFunc 179: env$runWith 172: ctx$run 171: self$.updateValue 169: getXIC 168: renderPlot [/export/data01/shiny/rawrr/server.R#203] 166: func 126: drawPlot 112: 96: drawReactive 83: renderFunc 82: output$xicPlot 1: runApp